DPCstruct | MC4147
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 184 ± 7 aa |
| Standard deviation of domain lengths | 7.33 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 90.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 19.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A399YNG3 | 32-219 | EFLCLLASRMFAGARLEIATDHVDYAEQITAVLQRSPHFESDLDVAFTRVDEGRVQTKYQQVALAEGRVPYFYKWRRNEVPAEDHFP… |
| A0A660RX74 | 3-196 | ADRLILNGFFIMVTDYKEYAEEVVNFFLNCPSFCPLWDSVIKNSLPHYYHTKYARKWLSAGLPLFYIGFKKIKHISIPEWVYTLYPL… |
| A0A7V4KDI4 | 26-213 | None |
| A0A7C5FDB7 | 2-173 | None |
| A0A0D2IXX7 | 94-271 | None |
| A0A1V5JTQ4 | 2-179 | None |
| A0A5M9QQF0 | 220-413 | None |
| A0A1V6GW23 | 134-322 | None |
| A0A7C5W0B9 | 57-241 | None |
| A0A662CQJ8 | 354-529 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.