DPCstruct | MC41469
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 57 ± 3 aa |
| Standard deviation of domain lengths | 2.70 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 93.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 61.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A212DUX7 | 5-58 | MDIDAILARRPKLVLVDELAHTNAPGSRHPKRYLDVQEILANGIDVYTTLNIQH |
| A0A810MDL3 | 73-127 | EMDVDALLARRPQVAVVDELAHTNVPGSRNAKRWQDVHELLDAGISVLTTVNVQH |
| A0A2X2CSV0 | 64-128 | None |
| A0A7U1EK66 | 73-127 | None |
| A0A7T0GMA8 | 87-145 | None |
| S6FDJ2 | 3-58 | None |
| A0A840ZR92 | 13-71 | None |
| A0A2R7R615 | 87-145 | None |
| A0A2Y4Y546 | 37-88 | None |
| A0A829Q8C7 | 78-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.