DPCstruct | MC41467
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 281 ± 39 aa |
| Standard deviation of domain lengths | 39.16 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 24.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A212DPC1 | 2-296 | TRLAEQMHSAFRQWRWREPLEDATLRNVVALASVRPPTFRAPIHPDLAAFTASSGHDVTQDIATDVLSGEWFADKSLFHVKSENFGF… |
| A0A6N7FDT3 | 13-234 | TLESYYLRRDNFGFAAPKGTVAIVEAEPLPVADRRLVIARHGQDTYARRLLRSNDSTLIGLTAETPDPRRSPKTKFLPESEVALHQV… |
| A0A1I4B3S5 | 161-395 | None |
| A0A149S9P9 | 175-478 | None |
| A0A853I4R5 | 1-195 | None |
| A0A259LP47 | 403-706 | None |
| A0A512IP88 | 15-290 | None |
| A0A418SJM1 | 824-1133 | None |
| A0A7S7THI6 | 476-780 | None |
| A0A2S8GQA1 | 983-1249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.