DPCstruct | MC41465
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 77 ± 6 aa |
| Standard deviation of domain lengths | 5.62 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 37.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A212DKZ3 | 1-84 | MFAEVVATDGPINARRKKALEDLANDAGFPLEHVAFLTAYLDRSRPSFKKAVDSLAWGSFAWFSAEPDHLMELDLPLSFSSTRS |
| A0A7T9D701 | 66-129 | GPIDSSRLAELKEWSNTALYPRVYVSVFASRKDYVAHMDVQAVDTFVWFADEPKHHLFLSGSPQ |
| A0A1E3XBH1 | 150-226 | None |
| A0A1F9BAN9 | 1-73 | None |
| A0A6L8FY67 | 541-617 | None |
| A0A2X2IE16 | 49-125 | None |
| A0A829BAZ1 | 101-178 | None |
| A0A533QDJ4 | 26-101 | None |
| Q8YQW1 | 463-546 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.