DPCstruct | MC41464
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 205 ± 5 aa |
| Standard deviation of domain lengths | 5.21 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 85.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 46.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059- CL0103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H4M7Q5 | 496-710 | MVVAPYATLLALMVSPQKACENLFRLQKNGACGEYGFYEALDYTPSRLATGQLYAVVQSWMAHHQGMAFQALAHVLLDAPMTERFMS… |
| A0A7W3WFT7 | 83-283 | VVISPYASVLASQFKPREAVVNLGWLASIGALGVYGYYDAVDFTETRLPEGQSSAVVRNYMAHHQGMSIAAIGNVVLNGRLRDRFHS… |
| A0A7X9KT45 | 181-383 | None |
| A0A1Q8A1K6 | 72-280 | None |
| A0A379ACI0 | 358-564 | None |
| A0A7X6Y2E4 | 265-464 | None |
| A0A485D6I4 | 172-371 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.