DPCstruct | MC4146
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 115 ± 4 aa |
| Standard deviation of domain lengths | 3.87 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 93.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 31.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A660RU09 | 21-141 | VCCGCGTAEALIIGIKKVVGIIGGNISNYSINEDTAYVKLWSEKEKRARNADIDMLLIAESEDMQDENEYDKAIDAVYNVLVNDRTR… |
| A0A7C4ZY81 | 272-382 | GCRACKQSREILNLKGQIVVVLNRQMVKEQSLEGDTLRVNWLTRRQLFDFDKVEIVQASDEEVERFAVQVGNDTDPVRQPRYKQMQC… |
| A0A1V5LXF5 | 339-459 | None |
| A0A3M2G7A3 | 412-521 | None |
| A0A3M2FT02 | 297-407 | None |
| O26610 | 358-470 | None |
| A0A842YKJ7 | 202-317 | None |
| A0A7C4VXP2 | 441-555 | None |
| A0A7J4MYQ2 | 100-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.