DPCstruct | MC41459
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 155 ± 24 aa |
| Standard deviation of domain lengths | 23.89 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 69.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14901 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I8NWQ6 | 14-179 | NEFLARLQDDLKEAMNTMVCSRCKGKHRRFEMEREPHSARYCAPCSRLHPATEGDLWAESSLLGLKITYFALMDGKVYDITEWAGCQ… |
| A0A091E3N9 | 100-232 | LSKLQDDLKEAMNTMMCSQCQGKHRRFEMDWEPKNSRYCAECNKLHPAEERDFGAESSMLGLKIAYFALMDGKVYEITEGTGCQCMG… |
| A0A6J2G7R1 | 290-468 | None |
| A0A0B1T5J8 | 2-133 | None |
| M4EB72 | 284-411 | None |
| A0A443Q413 | 179-286 | None |
| J9E926 | 5-171 | None |
| A0A1D6GDW4 | 217-412 | None |
| A0A3S3QFA2 | 1-138 | None |
| A0A6P5G470 | 484-632 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.