DPCstruct | MC41458
Metacluster Properties and Pfam Annotations
| Number of structural domains | 169 |
|---|---|
| Mean domain length (aa) | 100 ± 15 aa |
| Standard deviation of domain lengths | 15.24 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 22.92 |
| Pfam Score | 93.62 |
| Assigned Pfam label(s) | PF02563- CL0072- CL0039 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V6JHE8 | 20-117 | PQLELFRQNYQYRIGVGDVLNVTVWDHPELTTPAGQYRSASDTGNWVHTDGSIFYPYIGRLQVAGKTLEEVRSLIAARLAEVVENPQ… |
| A0A7C0WND8 | 25-98 | RKYTLGPDDAVRVVVRNHPEFDFGAMVEEGGELVIPLTNEIMQADGLTRDELAETIRQYLTAYIDNPFVSVFIT |
| A0A1V5FRN5 | 76-172 | None |
| A0A517NX46 | 57-182 | None |
| A0A081BTC4 | 14-112 | None |
| B9X9K9 | 721-836 | None |
| A0A419DUQ8 | 13-100 | None |
| A0A1G1AGP4 | 291-394 | None |
| F8J9B7 | 42-157 | None |
| A0A849GJM3 | 6-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.