DPCstruct | MC41454
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 138 ± 22 aa |
| Standard deviation of domain lengths | 21.92 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 30.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U9HPR8 | 1-135 | MTALVIDDIPAAIKNVKRQLRQALPNYREVFLALEDNIRQQVEQIRQELAAGHNPVPQIDAEDILQQRVSEQQKALIRQRGACAIRG… |
| A0A844F1R6 | 6-106 | TSDTLPADHKAAIRQMKHALRAQLGDVQQIFNQLSDDIATRVAEINALKAQGDAVWPVLSYADIKAGHVTAEQREQIKRRGCAVIKG… |
| A0A4U0XQZ3 | 3-158 | None |
| A0A0C9T258 | 6-109 | None |
| A0A2T6ZIK3 | 10-152 | None |
| A0A2T6ZJC2 | 24-133 | None |
| A0A0A2V5P3 | 2-172 | None |
| I8TJ11 | 40-170 | None |
| X0AIU9 | 1-137 | None |
| A0A427YLG7 | 24-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.