DPCstruct | MC4145
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 123 ± 7 aa |
| Standard deviation of domain lengths | 7.03 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 69.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S3JGG1 | 46-159 | IAATATSVRATTTASADSSAVTECHKHGDDVFCIESDGSEVQVSLESTPTGELPAQYTGCHSHGSERFCLDPDGNDVQILKEGETTD… |
| A0A1L9PA01 | 1-117 | MKIVVPVLALAGLVRAVSITGCHQHGSDVYCITESGEEVQVALDNPPAELPSEYTDCHTHGDKSYCVDPNGEDVEVLGEVTSSGTNS… |
| A0A060T283 | 92-217 | None |
| A0A0P7BEU5 | 1-123 | None |
| A0A0J9XJG0 | 1-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.