DPCstruct | MC41449
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 94 ± 7 aa |
| Standard deviation of domain lengths | 7.42 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 20.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N0XC41 | 53-150 | KNRIYQNSFEPYRSWNYKKIIVKPNTARQNSNYYVSELKKLQQRNQKETGIEFIINDENSYDDFISILNDCHISKQEMYGVDMDKTW… |
| A0A173MII5 | 2-96 | EAELKKRGILFPPPRQYISIELDNNQETNKIKLTFSAIRIQEMITQNDTVNGIHYHFTDHCTYKNFLCVLNVLCQMHRVQWHMHDGT… |
| A0A327VQM8 | 11-110 | None |
| A0A1M5P6E7 | 38-130 | None |
| A0A369QMD4 | 6-82 | None |
| A0A378RMC6 | 10-102 | None |
| A0A3E1NTA2 | 42-127 | None |
| A0A5Q3QUC4 | 46-139 | None |
| A0A5B6TF58 | 33-138 | None |
| A0A7Y7NHN9 | 1-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.