DPCstruct | MC41443
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 168 ± 29 aa |
| Standard deviation of domain lengths | 28.82 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 68.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 29.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1N7UP53 | 1-141 | MAQAYINQYTTDLLSLKSRLLPGSSRALSEKFDALNLHLRHGLVTPGQRVIIPQEYGVACTADDAWLMRHAQEIRRRLDQDASAGTV… |
| A0A285Q8R3 | 119-283 | AEPGFHVVREVMSKSALLQSLYGDASAKPDSFDRLNPNIRERVLPGEMIILGDPNMLECTQEEADLMKVASQVNEQLRTLDEEEAQF… |
| A0A285Z3Z7 | 1-166 | None |
| A0A3S4GFQ2 | 2-170 | None |
| A0A0B5KR44 | 4-153 | None |
| A0A7V8KF52 | 1-116 | None |
| A0A2R7RSS3 | 69-208 | None |
| L0M6B2 | 247-497 | None |
| A0A423IPP4 | 97-296 | None |
| A0A495MJ24 | 162-325 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.