DPCstruct | MC41441
Metacluster Properties and Pfam Annotations
| Number of structural domains | 159 |
|---|---|
| Mean domain length (aa) | 454 ± 98 aa |
| Standard deviation of domain lengths | 98.15 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 82.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.75 |
| Pfam Score | 76.47 |
| Assigned Pfam label(s) | PF09791- CL0716- CL0042- CL0490- CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A135V882 | 1-448 | MSTYGEGDPSDNAQNFVNWADAATCVSLAHLKYAAFGCGNSNYRFYNKVIDDVVVALTKFRAIAVLPTGKGDEATRTSEKDFMDWKE… |
| A0A0R2RQ95 | 7-332 | SGPTYICGDSLGVVPRNPDSLVREFTQRLGLHEDAALHETIATSAVLNRAGKKFVKAVAEKATGTAREKLQAICADEKKLDEYVFDR… |
| A0A819S8U6 | 179-639 | None |
| A0A146KD23 | 12-397 | None |
| E4V4E6 | 372-931 | None |
| A0A2C9JBG8 | 127-521 | None |
| A0A377CVH7 | 1-212 | None |
| W9WW32 | 23-389 | None |
| A0A820FKY3 | 2-263 | None |
| A0A1I8FC99 | 2-474 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.