DPCstruct | MC41440
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 152 ± 11 aa |
| Standard deviation of domain lengths | 11.32 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 65.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 43.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C4JT87 | 2-149 | PTSNSLKRHATHLSTTVASTKRSKPNQTITSFFKASTEKGENDSNIGPGLAKFNKEEWVQSLTSEQRELLKLEIDTLEDSWLAHLKD… |
| A0A135V760 | 1-143 | MSTLKRKAGTLSASDSKKPKQDGSIMSFFGAPKPAAGNKGAGSTAAGAGAGAGAAAASEAPAVKFDKAKWVAGLTAEQKELLQLEIS… |
| F0XN40 | 1-132 | None |
| A0A5N6KTL2 | 664-837 | None |
| C9SH11 | 2-157 | None |
| U7Q5Y6 | 1-152 | None |
| A0A2N5RZV2 | 1-154 | None |
| A0A3M7HCG9 | 2-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.