DPCstruct | MC4144
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 201 ± 22 aa |
| Standard deviation of domain lengths | 21.52 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G0K966 | 56-256 | APPHVTADASIWSLLAANTAALVAAAYFEWSPNSLMLVYWSQSIVIGISYFFRILALDRFSTENFRINNRSVAPTAATKIQVAFFFA… |
| A0A7Y1X7G6 | 2-166 | GWDVGSILLLYWLESVVIGLLNVPKILSARGNIFGKVFDSAFFTIHFGGFCAGHVFFLKEMFEVDISLPVLFSFNPITIAAASFFIS… |
| A0A2U2JD31 | 5-173 | None |
| A0A7U6GK27 | 6-200 | None |
| M0D2W5 | 2-192 | None |
| A0A521VM14 | 214-427 | None |
| A0A1F3S219 | 7-209 | None |
| H2CIL0 | 23-265 | None |
| A0A0S8BC81 | 83-281 | None |
| A0A7V8AED9 | 5-230 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.