DPCstruct | MC41439
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 124 ± 16 aa |
| Standard deviation of domain lengths | 15.90 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J4G856 | 1-152 | MGKLKWVFVFCICGFVTSGQNHSVTKVDDKKSENLASLAKVWGFLKYYHPNVAKGNFNWDEQLIQMIPKVEQAQNKDDLSRIYLEWI… |
| A0A290WZ68 | 36-152 | RIGLDTVTPVQVDNLAVLGKVWGFLKYHHPLITAGGRQWDYELLRVMPRMLAAPDRAAGDAVLREWIAGLGTLGDCDPCAVPAQGEL… |
| A0A1K2III2 | 13-131 | None |
| K1KZP6 | 33-140 | None |
| A0A520BPM1 | 37-164 | None |
| A0A2S1YIM7 | 1-134 | None |
| A0A3D8YE89 | 198-313 | None |
| A0A519S0R7 | 14-121 | None |
| A0A4U2KS32 | 18-127 | None |
| C1ADE4 | 40-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.