DPCstruct | MC41437
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 79 ± 20 aa |
| Standard deviation of domain lengths | 20.02 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 87.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 40.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G0SSZ1 | 1-73 | MLYSKLFGKTTKTVTKDAVAISHRLLLQGGFIRQLAAGRYSFLPLGLKVCKKIEQIIREEINKTGAQLRIYSW |
| A0A496M9S3 | 1-72 | MKQSKMLIPTLREMPSDAQVISHALLLRAGYVRQVSAGVYSYLPLANRVIEKAKNIMRQEFEKIGAVEMLAP |
| A0A0B4W8G8 | 1-48 | None |
| A0A7R9A5B3 | 3-116 | None |
| A0A2H2ZQT7 | 1-131 | None |
| A0A2X1JKL8 | 1-78 | None |
| A0A7J6YRD2 | 1-72 | None |
| A0A1A9Z0W4 | 1-73 | None |
| Q7P4P2 | 5-76 | None |
| A0A2J1DVN2 | 1-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.