DPCstruct | MC41433
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 205 ± 36 aa |
| Standard deviation of domain lengths | 36.05 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0316 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7EA02 | 4-204 | TDTTMTERRHDIDALRVFAFALLILYHVGMAYVADWDFHLKSVHTAQWLQWPMIVLNRWRMPLLFMISGIAIGLSRPQARPWRFALQ… |
| A0A519RF65 | 3-239 | KALNRNLWVDYLRSALTVLVVAHHASLAYTTFATFDKVAYIRSTHAIVDSKRWVGLDIFENFNDVFFMSLMFLIAGLFLSKSIEKKG… |
| A0A413UL68 | 1-146 | None |
| A0A2E7RX30 | 13-255 | None |
| A0A424YIQ2 | 1-206 | None |
| A0A1V4YL64 | 2-183 | None |
| A0A2E9NS80 | 1-268 | None |
| X1D9I1 | 2-172 | None |
| A0A7I8MYW0 | 35-202 | None |
| A0A1V5C5J3 | 2-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.