DPCstruct | MC41432
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 152 ± 19 aa |
| Standard deviation of domain lengths | 18.65 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 16.99 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | PF20009- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q3WNE9 | 3-140 | SSVSLVASGCTGDGTRVRWYQAADDQELTMPISPTVTTQYYARCERTVGTKVCLSDKSQNAIVTVVMPPPYNSVQSGNWNLPSTWNC… |
| A0A4Q3R1Z3 | 2-140 | VFYSAQGTSFQWQVDDGTGFKNIQDGAVYAGATNQYLQLTQPPTSWNGYNFRCVVTKNGVPTFSPVRVLKITFNWKGTVDSSWENPS… |
| A0A497CNM5 | 372-546 | None |
| A0A286FH65 | 427-575 | None |
| A0A661A0Y2 | 39-207 | None |
| A0A521G9I1 | 389-559 | None |
| A0A6M0IJD0 | 516-658 | None |
| A0A6M0IG70 | 517-662 | None |
| A0A661ZUH2 | 304-482 | None |
| A0A3D5HNT2 | 132-285 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.