DPCstruct | MC4143
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 219 ± 26 aa |
| Standard deviation of domain lengths | 26.25 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y4VY03 | 18-202 | SYRTRPFSEARRPYEHWQHADVLLAGASSEFHRIDIVTTLKRAVELRLKPLNEIYAFRRIPLPAMPEDRLTQLSYLGIIRPLLIARL… |
| A0A1F8KN90 | 25-268 | KTLGFAEGKRHFLRYTLESGFAYYTRVNLKGPQPFEYLSYAKNDVCSEKIQGAINGLSNANRAMHLTIESLFKVWGLKTAYSRANFP… |
| A0A356RDT9 | 3-206 | None |
| A0A6G2WKB9 | 17-266 | None |
| A0A1G5BI27 | 24-245 | None |
| A0A1C0UW39 | 4-210 | None |
| A0A2T1EQE9 | 42-274 | None |
| A0A2P2DQS3 | 4-240 | None |
| A0A1V5APU8 | 30-233 | None |
| A0A7Z9BQJ2 | 77-322 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.