DPCstruct | MC41426
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 108 ± 4 aa |
| Standard deviation of domain lengths | 4.34 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 85.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 44.54 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | PF00909- PF05197 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D5RMM9 | 1-115 | MDLMSALSLGELALSFSRVPLFPVFDLSYFIVSIIYLKYEPGAVELSRRHPVASWLCAMLHCFGSYILADLLLGEPIIDYFSNSSSI… |
| A0A4Y7NJS4 | 2-107 | IDPEAFLDLANQVTKLKMWPYFDIAHVVMCCLAVREDLGSGSITFSRKHPIACWLSTMMVVFAGGFLAALFLGEPLLTPFRDTQAVL… |
| A0A7M3Q4Z9 | 674-785 | None |
| A0A2U9C2F1 | 1-110 | None |
| U3KHH5 | 207-307 | None |
| G3P0Z1 | 12-118 | None |
| A0A814FIH9 | 1-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.