DPCstruct | MC41409
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 95 ± 14 aa |
| Standard deviation of domain lengths | 14.25 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 42.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00330 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P6BZ23 | 3-89 | NPFVHLAEPLDPAQPGKKFFNLNKLDDSRYERLPFSIRVLLEAAIRNCDQFLVKKNDVENILNWNIMQHKNIEVPFKPARVILQDFT |
| A0A843X658 | 63-182 | GLLWRSPVSPRPRLGVMATLLERPERRIATMAKDNAFKDILTSLAKPGGGEFGKYYSLPALNDPRIDKLPYSIRILLESAIRNCDNF… |
| A0A5J4JI69 | 13-96 | None |
| A0A2T2URA5 | 10-106 | None |
| A0A7J6TTK5 | 570-658 | None |
| A0A0B1TPT1 | 3-82 | None |
| A0A7J7H9Q1 | 3-109 | None |
| A0A7N0TFJ0 | 100-184 | None |
| A0A6G0YA54 | 30-129 | None |
| A0A5C7IEB0 | 195-322 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.