DPCstruct | MC41406
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 255 ± 34 aa |
| Standard deviation of domain lengths | 34.49 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B3EN66 | 1-253 | MGISVYIASRDDRAKLIKTILLEEYGLEESFSEQIYNENVKSHFEILKDKISFLAETCYVDSFYRDSYYHYFSSKLNCYSRDCVRIS… |
| A0A0J6YVI4 | 2-190 | GARQVIVESAIDRSDIEKEIDDLNQALGGDGEAEAIAFNFFSENIEISKVQGSSDETFLGQAVLINYNYKNSSLPDFSSSYIYEAIF… |
| A0A315XUW6 | 7-294 | None |
| A0A3S0V7K9 | 1-238 | None |
| A0A6N4UXF4 | 11-252 | None |
| A0A1G1GVC9 | 4-306 | None |
| S2DVS1 | 1-287 | None |
| F2ARS7 | 2-265 | None |
| A0A2N1P520 | 3-256 | None |
| A0A1H7BHW3 | 8-271 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.