DPCstruct | MC41402
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 188 ± 37 aa |
| Standard deviation of domain lengths | 36.68 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 75.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 23.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04494 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9NYP6 | 7-190 | SLTLEQKIVSTVVEKEASRSNSFLYSSCNFDPTQVDLQFSRLKAWICGELNDEVWHCELAALLCPMFCHLYLEMLRVVPRHEVAKFY… |
| A0A7J7TV09 | 2-128 | YEEYYSGLKHFIECSLDCHRAELSQLFYPLFVHMYLELVYNQHENEAKSFFEKFHGDQECYYQDDLRVLSSLTKKEHMKGNETMLDF… |
| A0A3P3YGN4 | 2-240 | None |
| A0A8B6CM12 | 32-247 | None |
| A0A673K3U9 | 33-251 | None |
| D3ZIZ2 | 40-230 | None |
| L2GJT9 | 1-142 | None |
| A0A1V9ZRW8 | 8-221 | None |
| G3QRR7 | 188-344 | None |
| A0A3Q0KRC6 | 18-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.