DPCstruct | MC41401
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 63 ± 5 aa |
| Standard deviation of domain lengths | 4.84 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 58.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03676 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9NY64 | 90-146 | MHFSQAVAIIQSQVGIIKGVQVLYSDMNPLAVDLIIILPQDGIRLIFDPVVQRLKVS |
| A0A0L8FFC5 | 23-83 | MPFYQTVNILKRQDRVIKAVQIRYSNTQPLQMDLVVSLSQDGIKLIFDPVCQRLKIIEVFC |
| A0A444TL61 | 1-57 | None |
| A0A0V0XKZ4 | 591-652 | None |
| A0A1B0AYA4 | 310-378 | None |
| A0A1A9VYL3 | 35-103 | None |
| A0A5E4QYX2 | 23-87 | None |
| A0A2A4IVK6 | 23-91 | None |
| A0A0R3WSW4 | 21-85 | None |
| A0A5B7K1B4 | 1-61 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.