DPCstruct | MC4140
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 107 ± 12 aa |
| Standard deviation of domain lengths | 12.47 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 25.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B3RJ83 | 8-116 | VHADMLGLRSLTCTRWNPDAHSLFHPDACGGRWDWTGAGWEHSHLAGDGSYASRECLQVSRRADLVCTNPPFSRFTDYVPRLLDTGA… |
| A0A2I1IQI7 | 34-135 | THFHQLGLNTLTAVGMDGKDGTYYHQTKERKIHRPAQGCGRFQSQETTNALATANFVFTNPPFSILREFHHWLTKQPRLRYGIMAPT… |
| A0A5C8FW30 | 200-290 | None |
| A0A087CPP5 | 51-154 | None |
| A0A5P9XN41 | 20-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.