DPCstruct | MC414
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 210 ± 31 aa |
| Standard deviation of domain lengths | 30.96 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 22.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L0NJ21 | 38-240 | PPPPPPPPPPPPQQQPQPDDHEPIPLLQSLAPSIFVSLANDLAATPFVPPASRIARLNAILAALDTHAVHVRSNMLALVRRECVRIL… |
| A0A1Y2WMX6 | 1-219 | MAITTGSEREPERELEQEEDIPAYQNIAPSIFVPAQTDFTKPPPELPSEPVRRRAEILAQIDEHADAVQDNIYYMFNREKTRILQEC… |
| A0A545V7B9 | 52-293 | None |
| A0A370TRQ4 | 91-312 | None |
| A0A1Y2DYN0 | 1-265 | None |
| A0A1Q8RYD9 | 3-161 | None |
| A0A2A9PDU7 | 1-188 | None |
| A0A2C5X270 | 17-208 | None |
| B2AZM2 | 18-190 | None |
| A0A162MN73 | 10-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.