DPCstruct | MC41399
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 128 ± 15 aa |
| Standard deviation of domain lengths | 14.71 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9NV84 | 34-144 | TRKNVPVILLTGDDWTWLAKIKTVLNNGIGDCSRVFVAVHTASLGDWRLLIKQLSNEPKAEKLRYIFVLDKHAPKFSLDEDFYQQQL… |
| A0A7R9HD39 | 1-110 | VVVEVTEKNYSWVDRLKSTLKQSESEGQKVLVLVQGENLSGIVGLINCIKQEPGGSNVRCVFLQDPKTPKFSISDPMYATQLKKDLV… |
| A0A3S3Q7X4 | 307-461 | None |
| A0A0A9XPY1 | 94-208 | None |
| A0A0A9Y3U2 | 67-188 | None |
| A0A6J1QE43 | 659-775 | None |
| E9INQ3 | 288-421 | None |
| E9IZ37 | 375-498 | None |
| A0A2P8YSV4 | 115-248 | None |
| A0A822HDW5 | 1-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.