DPCstruct | MC41398
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 128 ± 13 aa |
| Standard deviation of domain lengths | 12.56 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 39.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9DV77 | 1-117 | MACSLLETCGRFLYRSPETKIRMSNMLEIVRRLKNVKNLDLHHSTLVENAYYLCKPPERSSRVSKVWPPLHQYIRRLLFSNLDKSTV… |
| A0A428T1C3 | 58-180 | KVSLDDFSRMNIEILCNLIENCGRYLLRNPETAPRMVSFLETLQRKKSVQHIGQPERMLIDNAVYYVDPPERPAIEQKERTPMELFV… |
| A0A3P7MXH9 | 42-158 | None |
| A0A7J7KU23 | 262-391 | None |
| A0A7S0R638 | 2-146 | None |
| A0A177B4J9 | 1-112 | None |
| D7LD54 | 7-139 | None |
| A0A183RVC1 | 170-299 | None |
| A0A7R9DQZ2 | 10-120 | None |
| A0A811R179 | 441-567 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.