DPCstruct | MC41396
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 130 ± 9 aa |
| Standard deviation of domain lengths | 9.32 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 50.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19422 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P5Z7W7 | 334-454 | VTNGLCRLFRSRRVLSYSYPFAFYMFGEELFKDEMTNEEREMKQHLFEDQQQQLEANVEKLSKFLEEPFDQYPDDKVMEIRMQVINL… |
| A0A4U6TA05 | 227-346 | VINGLNRLFRSRRVLSYSYPFAFYMFGDEIFKDEMTPEERELKQNLFEDQQQQLEFNVERLSGFLEKDFQNFTDDEVMDTMKHVINL… |
| A0A287WS25 | 44-184 | None |
| A0A218XH38 | 1-145 | None |
| A0A2U1Q733 | 36-165 | None |
| A0A7J7D324 | 397-517 | None |
| A0A446R6B6 | 132-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.