DPCstruct | MC41395
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 80 ± 9 aa |
| Standard deviation of domain lengths | 9.26 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 47.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B0NQ49 | 31-118 | WDLRKMISGAEFEAMKKPRTFINGWDYRHGSYARPKYLQHPQDSSVVTYRGHSVLNTLIRVHFSPPNTTGQRYIGSGSADGNIHIWNL |
| G0QXN2 | 177-254 | KPRKNYNYDYRYGPLNQQEVLEISKLTQQQNYDNSIHTFRGHSVSRTLMRCHFSPQNMTEGRYLYTASSCGKLYMYDI |
| A0A446J2L1 | 1-86 | None |
| A0A7S4HMN5 | 1-93 | None |
| A0A287DTL4 | 1-61 | None |
| A0A7S2T5U4 | 60-140 | None |
| A0A0F7RZL3 | 1-74 | None |
| M1W3G3 | 471-546 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.