DPCstruct | MC41390
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 267 ± 34 aa |
| Standard deviation of domain lengths | 34.48 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 73.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 18.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18293 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A674IBS1 | 23-272 | LQSSLNSAATPSQAYETYIDNGFICLKHKIRNIEKKKLKLEDYRDRLKKGEALNQDQLEAVEKYDEVLHNLEFAKELQKTFSGLSQD… |
| A0A0A9D3T6 | 9-287 | AAASAAAETTDGPVLSVISKRLRALRKKYNRITQMEESLAAGKTLNREQEEVLRSKPVVAALIDELERLRAPLASAAAEEVSSRPAP… |
| B6JY19 | 13-304 | None |
| A0A2T0FCF4 | 3-210 | None |
| A0A0C2WLV7 | 40-337 | None |
| A0A1S3Y8X3 | 1-231 | None |
| A0A139AWU1 | 1-298 | None |
| A0A1C7N3A6 | 1-282 | None |
| A0A1J8QTX8 | 6-269 | None |
| A0A0G2ETE7 | 446-839 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.