DPCstruct | MC4139
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 290 ± 36 aa |
| Standard deviation of domain lengths | 36.12 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 11.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A523RQH3 | 16-276 | TLEKTIRTITEREHMYDSALVAFALEKNDDQLMLCYGLVTFLPKDEKSIKELHYEYEKLILVRKCISVKEAIQLLRDMFENHKIDIP… |
| A0A2L2WRG8 | 3-303 | DSDYMILRLYVLRIGNGQKDCKYKIAYGIATPFVSGMTEPVISQFTKLGSFGKKCSLAAILIALETDVIVSIYNDLLEGISFKSSLA… |
| A0A2N7CD55 | 2-278 | None |
| A0A410SFH4 | 1-345 | None |
| F2KEY5 | 12-291 | None |
| A0A556P6E5 | 42-401 | None |
| A0A4R6M466 | 10-308 | None |
| A0A6S7BX11 | 2-313 | None |
| A0A6B0XEF0 | 102-407 | None |
| A0A523Q1E4 | 5-337 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.