DPCstruct | MC41388
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 216 ± 35 aa |
| Standard deviation of domain lengths | 34.78 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B8EW28 | 17-209 | TAWERRTEGWKHSRELLVKLLDGIARLKHGIGNNAMLLNPKTGEIRECPPPTPAYAISHLSMLFGFPEIFAGLLDYAKGEYPSAVGN… |
| A0A1I6R0W3 | 38-238 | STDWGAMGLAWLTEWERGGDPVARTKLLNGAASIAALPNGWAQGGATTYNLLDGRFTGPSEPSVSIGSLSSVFGLMELMTELLQLTD… |
| A0A1G0QUG4 | 2-172 | None |
| W4VPS5 | 50-254 | None |
| A0A2I0RZC4 | 361-572 | None |
| A0A6A6ZUW9 | 657-911 | None |
| A0A0G4LLD6 | 10-201 | None |
| A0A6G7Y2L8 | 696-941 | None |
| A0A1H4CLW7 | 816-1038 | None |
| R7DKK3 | 374-599 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.