DPCstruct | MC41387
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 300 ± 37 aa |
| Standard deviation of domain lengths | 36.54 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 23.37 |
| Pfam Score | 84.34 |
| Assigned Pfam label(s) | CL0197- CL0073- CL0026 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B8ET00 | 11-257 | KADIRADSNRDGKVDIHGRSDLHDKLSDCSDAGAIFLANIGDTDRRCSKLALSGPAPSNEELAARNDASDDIQRAPQYLAPLRTVPI… |
| A0A673TFS1 | 115-422 | AIEISLDVDADRDGVVEKNNPRKASWTWGPEGQGAILLVNCDRDTPWLSKEDLKDEKVYSKEDLKDMSQMVLRTKGPEQLPAGYEIV… |
| A0A674HN24 | 440-794 | None |
| F5UGR1 | 359-643 | None |
| G3IJW1 | 99-333 | None |
| A0A1R0KGI3 | 4-314 | None |
| N4XHF1 | 1-258 | None |
| W6YJ59 | 1-275 | None |
| A0A419HDR0 | 7-316 | None |
| A0A348PE94 | 578-856 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.