DPCstruct | MC4138
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 61 ± 7 aa |
| Standard deviation of domain lengths | 6.57 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 50.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00720 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5R9LPT9 | 64-122 | PVGPVPAGQMCSMIYGGSQTAQVTGTWHGAAVTEKYSRANGCEVARWNRMAPVLPAATG |
| F8JR57 | 78-144 | AACARLDELHGPVGPVPHGTVCSMLYGGPQRAWVDGRWRGVDVHENFSRRNGCEIDRWRLMEPVLPH |
| A0A6B3GZ14 | 1-48 | None |
| A0A538DM26 | 332-396 | None |
| A0A0K2RIJ5 | 1-61 | None |
| A0A640SKU4 | 241-298 | None |
| A0A0K2QX82 | 14-70 | None |
| A0A7Y9LF59 | 4-62 | None |
| A0A3N6GR39 | 17-74 | None |
| A0A7X6HC94 | 131-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.