DPCstruct | MC41378
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 183 ± 32 aa |
| Standard deviation of domain lengths | 31.97 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 73.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0511 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M5X4P3 | 29-206 | KMSITEQINTAIKDALAQSLGTIVEETTKEVKRSMQDDVTDTIVKKVRQEQVPTFKKKFNSDQYKHTKVMEKIMSKINSNLEANDIT… |
| A0A6J8BX25 | 28-172 | AADKSSDLVDTVELFKTILDSKLGELKSELIQQQDSLKRKIKEDVTLKFKGEGNRIQYTFNEELLETVNKLSKFIPSSNTQAYRLVF… |
| A0A3M6U8U2 | 1-150 | None |
| A0A7M5V2X1 | 2-263 | None |
| A0A6S7HSU0 | 2-169 | None |
| A0A1X7SM74 | 1-171 | None |
| K1Q494 | 24-220 | None |
| V4ALC9 | 12-204 | None |
| A0A8B6ESU7 | 14-206 | None |
| A0A6J8EWD2 | 1-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.