DPCstruct | MC41376
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 193 ± 24 aa |
| Standard deviation of domain lengths | 24.49 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0061 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M5X214 | 1-252 | MWETVARDDDPFICCNFIPLDLKELQEKGFSFKTQQDVHDYIKKHIIGKPNEQLVKNVHKEIDFLGIVGPDALINSFTVNCKGQSTG… |
| L8WH82 | 174-351 | WATMDMDDSSLIVVPLKAIPAERQQLGQDAIRKQREYIRDTIVNRPNEELVQDAKAMSLLHEMVSDLSINAFACNFRLPNGEVNSDV… |
| A0A2I2GMI9 | 512-686 | None |
| A0A1J9RPZ9 | 562-773 | None |
| A0A7M5UXP6 | 440-665 | None |
| A0A7M5V8V5 | 1-156 | None |
| F8NVA3 | 451-584 | None |
| A0A0F0IE73 | 152-354 | None |
| A0A3C0I1K6 | 299-474 | None |
| A0A397V2X7 | 228-409 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.