DPCstruct | MC41374
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 210 ± 23 aa |
| Standard deviation of domain lengths | 23.22 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 35.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M5UZ14 | 151-386 | RHQELISHYCMPLVKVEFAGQSNSAKSDKSDEGIVLNLGLYLSLLDRVIRKYKIVKDFTVEDEEFKLLLKLVASKRKLKDESTDMCF… |
| A0A7M5WWX9 | 7-200 | LAVLLQSLHKFLQSFSNVDDITGEEEEYRYYIQGLMERRNQNDMEKFWKDAMKFIDIYKQRGVQSEDLNHTNYWGTRQQLLAGKVIA… |
| A0A6P8HI41 | 5-238 | None |
| A0A7M5V0J2 | 351-578 | None |
| A0A7M5UMQ8 | 4-202 | None |
| A0A6P8I6Y7 | 41-267 | None |
| A0A136LJ26 | 2-183 | None |
| A0A7M5WWX4 | 1-161 | None |
| A0A2A4ZEJ4 | 148-378 | None |
| A0A847AZ56 | 38-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.