DPCstruct | MC41371
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 125 ± 19 aa |
| Standard deviation of domain lengths | 19.34 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 17.37 |
| Pfam Score | 60.00 |
| Assigned Pfam label(s) | PF15077- PF15744 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M5WQY2 | 5-141 | ILSDLKLPEPDVRLVVYNQTIVKVKLRCRNAQITGETNHESMKFWKKNKTQNDIKRAMKYILSGSNKIEPIRTDELVIYPYKREWPN… |
| A0A397HY89 | 1-106 | MELTPFLLEKTRLLVISNEVIQITLRSNNSYTTSYYNNNSQLQNEIKKIIIACVRIKNNDQIVDGQGFYLLCRKVNWRIGCRYNFTK… |
| A0A2T7PVB8 | 23-169 | None |
| A0A6S7GS96 | 1-142 | None |
| A0A3Q1ESP0 | 1-112 | None |
| Q2HCV3 | 1-178 | None |
| A0A3Q7VM75 | 1-125 | None |
| Q92358 | 5-130 | None |
| A0A6P6DJ33 | 1-123 | None |
| A0A6P8QY67 | 2-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.