DPCstruct | MC41367
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 223 ± 30 aa |
| Standard deviation of domain lengths | 29.95 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M5WIE4 | 78-305 | ETYQSCLDRTTKQKKRSVLNHAGNIANYVFDEKVFDKVKSFPPRTTINYKKLAEDYNLKHRITNKVPGHRGQIMEAILDQSDIDMSQ… |
| A0A6J8CVH6 | 106-424 | ERERKLYFTSKPKAKENMIVRVRKEMEGICKPKKHHGNFDNYIFEKEKFLEEISSLSAGSNVNWSALARKFDVKTIKNQVPTNRGQV… |
| A0A6P4Z5T1 | 41-260 | None |
| A0A8B6HKN4 | 53-286 | None |
| A0A8B6EYX0 | 329-563 | None |
| A0A7D9MDG8 | 3-181 | None |
| A0A6S7GUV1 | 85-278 | None |
| A0A6S7G116 | 2-201 | None |
| A0A7M5X6F1 | 14-253 | None |
| A0A7M6DQI5 | 21-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.