DPCstruct | MC41360
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 147 ± 32 aa |
| Standard deviation of domain lengths | 31.98 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 89.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 27.34 |
| Pfam Score | 86.61 |
| Assigned Pfam label(s) | PF04295- PF20629 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y0L1N8 | 4-142 | EFMGYRRSGGHVGVRDYLLALPSVVCATRAAFWAVEGTDAIAIEHPIGCAQIGADREQTRRVLVGIGAHPNVRAAMVIGLGCEGVPA… |
| A0A3A4W5N1 | 1-151 | MEKEFLGYARPDGSAGIRNHVLVLPVQRQMNIVAKKISETVPGTRTLIYPGELGRPRNDRLVIYRTLTGLGLNPNTASVLVIGSRRQ… |
| A0A377Z147 | 3-166 | None |
| A0A6M1I3U0 | 61-170 | None |
| A0A6D0M2B4 | 70-227 | None |
| A2WIZ4 | 421-559 | None |
| A0A7C4GAU5 | 1-99 | None |
| A0A7X6FU40 | 1-144 | None |
| A0A168PD83 | 1-132 | None |
| A0A447TV03 | 1-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.