DPCstruct | MC41357
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 54 ± 5 aa |
| Standard deviation of domain lengths | 5.24 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 36.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18930 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2Y9L0 | 13-72 | PAEMGKTGAESGEMAYCVKCRKKSPMVETQRVTMKNGRPAISGKCGVCGTGMYKILSQKK |
| A5UQY4 | 211-258 | IGWCARCREHHPMQRVTYTTNASGRPIARGVCPVCGAGITRFVAWGQR |
| B9XPD1 | 2-51 | None |
| A0A0F9UPK3 | 1-50 | None |
| A0A523S8C3 | 45-103 | None |
| A0A5J4DS22 | 1-47 | None |
| A0A1F8RF01 | 4-52 | None |
| A0A7C1KXV5 | 43-98 | None |
| A0A482F1H6 | 8-64 | None |
| A0A662ULQ7 | 1-49 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.