DPCstruct | MC41354
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 90 ± 8 aa |
| Standard deviation of domain lengths | 8.37 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 75.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2U8H0 | 1-90 | MQLLDLKTKDFWSGKFTELKSKLEELEVQKCMHIAQHKWTALKEIPRVEALIFGAWNSLPECYSEVKKLAYGVLTIFGSTYSCEQAF… |
| A0A4Y2KP50 | 44-123 | SLQMQLLDLKTKDLWSGKFTEFKSKLEELEVQKCMHILQQKWTALKEIPRVEALIFDAWNSLPECYSEVKKLAYGVLTIF |
| A0A4Y2CL35 | 11-95 | None |
| A0A4Y1ZNY0 | 43-120 | None |
| A0A4Y2LYS4 | 47-136 | None |
| A0A4Y2S7U3 | 13-115 | None |
| A0A4Y2IQG1 | 22-112 | None |
| A0A4Y2J8D2 | 1-91 | None |
| A0A4Y2UB62 | 1-106 | None |
| A0A4Y2S8Q7 | 81-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.