DPCstruct | MC41351
Metacluster Properties and Pfam Annotations
| Number of structural domains | 72 |
|---|---|
| Mean domain length (aa) | 127 ± 20 aa |
| Standard deviation of domain lengths | 20.38 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 17.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5M9LJI7 | 4-103 | INNPKRVVLRFSVQYEREEATINEQFFALHGPEPPNEDFFSHLMAPNESSKMHIVLDIYCKSHPTIDNSMIPYEVFKVKKNGNFKFK… |
| A0A6A5W1Z4 | 9-148 | AYINAKKPVRILVIIYPISPLFANSEIAAILQQALTSLQAVEMDAKTISLSTWPNRTLMVFDLCHDEYNFNEAHYPENLPVVTIHFQ… |
| A0A6A6Z6N2 | 80-232 | None |
| A0A2B7WWQ4 | 1-143 | None |
| N4X3H0 | 1-115 | None |
| A0A6A5X3W0 | 1-108 | None |
| A0A4S9MDI6 | 8-123 | None |
| A0A2V5ID50 | 11-138 | None |
| E4ZPP0 | 36-153 | None |
| E4UTF9 | 19-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.