DPCstruct | MC4135
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 120 ± 24 aa |
| Standard deviation of domain lengths | 24.38 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 86.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 30.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K3ASR8 | 267-391 | AYYLLINDLKNKNVDFGKLYKYSELNPNKPFIIPELKDYNCLKMLEKHFLDSFEKLPEVYSVMEISYECEGEIFSVDNVKLEYNNLI… |
| A0A3B8LFN9 | 17-119 | EFQAGFTPEQLPATNLKTLAPLVFSCFQQAPPIEDPLLIRYEWQQDKSLLGVDAFPHSEAWLKIQINQTMPFWLGKRPARFVPHNEK… |
| A0A1Y2BWE7 | 109-278 | None |
| A0A2Z6R1N6 | 57-159 | None |
| A0A843XBN8 | 95-197 | None |
| A0A1A8ZF79 | 254-386 | None |
| A0A3M7MEY4 | 655-780 | None |
| A0A2K1IFQ9 | 336-455 | None |
| A0A2Z6LXL9 | 287-403 | None |
| A0A484N5N0 | 116-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.