DPCstruct | MC41348
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 102 ± 10 aa |
| Standard deviation of domain lengths | 10.25 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 38.96 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0070- CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7KMN9 | 1-115 | MPKFKYANNLRRNRGGPYKTEPVTELRRWRLRNVGGRQTWHYLESNEECEAWPQTLLDKHSLGLSTDDLAPSLPPATSAKASSYNAL… |
| A0A1M2V5Y7 | 14-110 | KLPFTDYSRWRLRVSEDGDHTWHYLHTEEEAADWAQTDCDKYWLGIPLDLPALPKPTNALEAARNGYRFFKHLQTEDGHWPAEDGGP… |
| A0A4T0Q8B7 | 4-93 | None |
| A0A177AJG5 | 1-99 | None |
| A0A7R8A8W6 | 18-115 | None |
| A0A5N6U892 | 1-92 | None |
| A0A6J0VD75 | 1-98 | None |
| A0A7M7SWD9 | 3-106 | None |
| A0A0C9MNV4 | 275-396 | None |
| A0A024SC02 | 10-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.