DPCstruct | MC41347
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 138 ± 18 aa |
| Standard deviation of domain lengths | 17.73 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 43.41 |
| Pfam Score | 96.67 |
| Assigned Pfam label(s) | PF10785- PF12853 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A317BJZ5 | 2-148 | RYTRPSDWAQGAALGALSPGLMLYWEKVSPSMVGKGGFAPIMRLSGAIGLSGCFIFAYSRSCMRFYGARENRREVEMDMREMVDKVK… |
| A0A7C8IJ93 | 2-119 | ERFAPSHVGRGGFARAMRLGGVIGAIGGFLYFYQRSCLRFYGMSENAREVELDMQEMVAKVKAGEPLYGESKLTPHMQGVAARQSRY… |
| A0A2N1JG14 | 2-110 | None |
| A0A197JYY1 | 115-213 | None |
| A0A0D7AX30 | 19-161 | None |
| A0A1B2JBY9 | 5-120 | None |
| R9P0Y7 | 72-210 | None |
| S3CKG2 | 26-170 | None |
| A0A2S5AZW9 | 2-124 | None |
| A0A1E3QVF3 | 2-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.