DPCstruct | MC41333
Metacluster Properties and Pfam Annotations
| Number of structural domains | 83 |
|---|---|
| Mean domain length (aa) | 129 ± 20 aa |
| Standard deviation of domain lengths | 20.01 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01867 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W7D3C3 | 10-142 | PSSAAPGDGSHRLRGLVHGAAEQIGLDPYVGYLHGIRPAKPALVLDLMEEFRAPLADRLVVTLLNRRQLRPEHFAHLPGGAVRLAED… |
| Q8DSM4 | 2-122 | LTYECQSALEAVGLDSYVGFYHTDRPGRASLALDLVEEFRSYIVDRFVFSLINKGQLSKKHFDIKENGSVILTEKGRAIFIEAWQKR… |
| A0A1Y4VDT1 | 189-327 | None |
| A0A1W1BCX0 | 297-449 | None |
| A0A2P1MJP2 | 4-135 | None |
| A0A5E6N7B5 | 27-160 | None |
| A0A353V2X4 | 250-387 | None |
| A0A3M1TRM0 | 714-881 | None |
| A0A5J5DYB8 | 163-300 | None |
| I0X7Z5 | 93-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.