DPCstruct | MC41327
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 104 ± 18 aa |
| Standard deviation of domain lengths | 17.82 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 45.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0715 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182U766 | 169-260 | TIIVLLNQQRKFEALDFCYHILRVQRVDGKDDTVKGINLKRMVDRIRRFQVLNSQIFAVLNKYLKSNDIEGSNVEHVRCFPPPPHPS… |
| A0A1S3MQF1 | 57-160 | TVEQCFGDGLHWAGCMIISLLGQQRRFDILDFSYHLLKVQKHDGKDEMIKSVPLKKMVDRIHKFQVLNDEIYAILNKYLKSGDGENI… |
| A0A183RJH3 | 156-282 | None |
| A0A443PDW8 | 131-284 | None |
| A0A1X7SSM3 | 109-203 | None |
| T1GBK7 | 2-86 | None |
| A0A2G5U729 | 16-104 | None |
| A0A183HLQ9 | 40-145 | None |
| A0A158PSI3 | 740-846 | None |
| A0A2U1KMN5 | 1-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.